PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G354000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 571aa    MW: 64469.3 Da    PI: 6.6181
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G354000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4219.9e-1292005692373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAea+s++  e+  +l+++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +   s e l+++k++++++P++k
  Sevir.2G354000.1.p 200 KQLLTKCAEALSEERIEEFLKLVQQARGVVSITGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCREPE---SNELLSYMKILYNICPYFK 287
                         689*****************************************************************9...99***************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         f++++aN aI ea+ +e+++Hi+Df+i qG+QW++L+qaLa+Rp+gpp++RiTg+++p s+  + e l  +g+ L+++ ee+++p+ef++l
  Sevir.2G354000.1.p 288 FGYMAANGAIAEALRNEDKIHIVDFQIAQGTQWITLIQALAARPGGPPHVRITGIDDPVSEyaRGEGLDLVGKMLKSMSEEFRIPLEFTPL 378
                         **********************************************************999999**************************9 PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                              ++++ e+L+++pgEalaVn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+ +n+++Fl rf+e+++yysa+f+s++
  Sevir.2G354000.1.p 379 PGVYATQVTKEMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFSETMDYYSAMFESID 469
                         888999************************************************************************************* PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+lpr+s+eri+vE+++l+++ivn++aceg++r+erhe l+kW++rl++aGFkp+pls+++++ ++ ll+ ++ d y++ee++g+++lgWk
  Sevir.2G354000.1.p 470 ANLPRDSKERINVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFKPYPLSSYVNSVIRKLLACYS-DKYTLEEKDGAMLLGWK 559
                         *********************************************************************9999.55*************** PP

                GRAS 364 drpLvsvSaW 373
                         +r+L+s+SaW
  Sevir.2G354000.1.p 560 SRKLISASAW 569
                         ********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.256173551IPR005202Transcription factor GRAS
PfamPF035143.4E-126200569IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MDLHQLLKYR LTGANVFYEF PTENNLANNP WPGTPLKSEF SNSPYTPLSA QLECDNLSAI  60
SNTPDNQSST ETISAQPISP LEVDSSNRQA GILWENTQVR PDHLYTTSRH NMQHALRKIE  120
TVLMAPDADD AATSTKHEFE EHKPAPLMRQ RSRTWSHELR QPSPGVVRTQ FASGYPTASY  180
EFRPEKRQRE LREDPQSMVK QLLTKCAEAL SEERIEEFLK LVQQARGVVS ITGEPIQRLG  240
AYLLEGLVAR HGNSGTNIYR ALKCREPESN ELLSYMKILY NICPYFKFGY MAANGAIAEA  300
LRNEDKIHIV DFQIAQGTQW ITLIQALAAR PGGPPHVRIT GIDDPVSEYA RGEGLDLVGK  360
MLKSMSEEFR IPLEFTPLPG VYATQVTKEM LDIRPGEALA VNFTLQLHHT PDESVDVNNP  420
RDGLLRMVKG LSPKVTTLVE QESHTNTTPF LMRFSETMDY YSAMFESIDA NLPRDSKERI  480
NVEQHCLAKD IVNIIACEGK DRVERHELLG KWKSRLTMAG FKPYPLSSYV NSVIRKLLAC  540
YSDKYTLEEK DGAMLLGWKS RKLISASAWH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-6022257026375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278600.0KJ727860.1 Zea mays clone pUT5952 GRAS transcription factor (GRAS49) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957943.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLK3ZRC60.0K3ZRC6_SETIT; Uncharacterized protein
STRINGSi029156m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106313643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-180GRAS family protein